SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014E3P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014E3P9
Domain Number 1 Region: 6-188
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.4e-39
Family PP-loop ATPase 0.0000844
Further Details:      
 
Domain Number 2 Region: 192-274
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 3.53e-19
Family MesJ substrate recognition domain-like 0.0036
Further Details:      
 
Domain Number 3 Region: 294-393
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000000392
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A014E3P9
Sequence length 417
Comment (tr|A0A014E3P9|A0A014E3P9_9GAMM) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome OX=1310914 OS=Acinetobacter sp. 25977_10. GN=J813_0774 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MTQIFPQKIRVIYIDHQLQEQSAEWGKLVASQATSLNISYIIQKVQISDGNLEAQARQAR
YQAYQQHLQQNEILLLAHHQQDQAETAILRLLSGTGVDGLAAMQAIDYRENMTIWRPFLD
LTREQIASWAAQLEVKYIDDPMNYDTHYDRVWCREELWPFLSKRFPKMQQALSRTSYLMQ
DASEILEEVLKNDWQYSGSADYLDLTKLSELSFARQRQLLSAWMKGDGQYRPAFEMVERL
KKEVIDSKSDAQAALHWNQFYYVRYQNILYRLSKQIYLAEKLNLVEAELEHSFKLQEEWQ
GAAGLFHIESKKIGLSHSLLNKKLKIIRRQGGEKIHLYGRVGQWPLKKAIQEAHILPWLR
HTIQILVIDNVMLGVFTPKGFWLAQSPYCEQGGWQPDLISHSCDLVNGEYGYDKCSK
Download sequence
Identical sequences A0A014BQZ9 A0A014CVR3 A0A014E3P9 A0A014EXC1 A0A062KYE7 A0A140QU70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]