SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014FEC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014FEC5
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 8.9e-37
Family N-terminal domain of MutM-like DNA repair proteins 0.0000772
Further Details:      
 
Domain Number 2 Region: 128-220
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.44e-28
Family Middle domain of MutM-like DNA repair proteins 0.00047
Further Details:      
 
Domain Number 3 Region: 215-267
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000202
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A014FEC5
Sequence length 274
Comment (tr|A0A014FEC5|A0A014FEC5_9GAMM) DNA-(apurinic or apyrimidinic site) lyase MutM {ECO:0000256|HAMAP-Rule:MF_00103} KW=Complete proteome OX=1310914 OS=Acinetobacter sp. 25977_10. GN=J813_0552 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MPELPEVETTKTSLFPLLNQKVLSVEVRNPSLRWPIPDDIQKLVGQRLIGLNRRSKYILA
EFEQDQMLWHLGMSGSFRLCQPNDELRKHDHLIIQFEDQQLRYHDPRRFGCILWLNPETQ
GKLIDTLGPEPLSTDFHAEYLASKLKNKAVGIKIALMDNHVVVGVGNIYATESLFNVGIH
PAQPAGDLTMQQIEKLVVEIKRILKSAIDLGGSTLRDYSNAMGENGYFQQTLLAYGRAGE
MCVNCETTLENLKLGQRASVFCPQCQPLKKLKKP
Download sequence
Identical sequences A0A014BG91 A0A014C882 A0A014CP58 A0A014CZH9 A0A014D2W1 A0A014D881 A0A014EUP7 A0A014FEC5 A0A062NAK3 A0A062SST7
WP_017393891.1.100576 WP_017393891.1.16924 WP_017393891.1.17678 WP_017393891.1.21600 WP_017393891.1.31793 WP_017393891.1.53546 WP_017393891.1.53558 WP_017393891.1.74078 WP_017393891.1.79917 WP_017393891.1.80429 WP_017393891.1.9755 WP_017393891.1.98939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]