SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014LWT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A014LWT7
Domain Number - Region: 52-126
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.0214
Family Hemopexin-like domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A014LWT7
Sequence length 129
Comment (tr|A0A014LWT7|A0A014LWT7_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EXU74061.1} KW=Complete proteome; Reference proteome OX=69222 OS=Erwinia mallotivora. GN=BG55_19390 OC=Erwiniaceae; Erwinia.
Sequence
MKKVISTLLALTLLSPALVSAHPGGWGPGPGPGPGWGRGWGHGPGRLSILPDAAAAVIIG
GLTYYALNGMYYQRQNDNTYVVVQPPAERLSGSMNAVDYNGERFYVQDGHYYRRDIDGRY
LEVPRPPGL
Download sequence
Identical sequences A0A014LWT7
WP_034940461.1.3328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]