SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A014NVK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014NVK9
Domain Number 1 Region: 10-115
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.47e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A014NVK9
Sequence length 130
Comment (tr|A0A014NVK9|A0A014NVK9_9ACTN) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=1158056 OS=Streptomyces sp. PRh5. GN=Z951_39315 OC=Streptomyces.
Sequence
MFDDRPAFGVRVQVLGGVTVAEIAGELDIFAAGRIVARLDSLVQVRCPDLVLDLRPVTFL
DCAGLSLLCRLRNRVLERDGRLRLVIADPRFLRLLRTVRLDGAFEVLEDLTPAIAGAAGP
VAGGGGDAFT
Download sequence
Identical sequences A0A014NVK9
WP_037962959.1.87540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]