SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014PTG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A014PTG5
Domain Number - Region: 75-163
Classification Level Classification E-value
Superfamily BEACH domain 0.0549
Family BEACH domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A014PTG5
Sequence length 165
Comment (tr|A0A014PTG5|A0A014PTG5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EXU74137.1} KW=Complete proteome; Reference proteome OX=69222 OS=Erwinia mallotivora. GN=BG55_19075 OC=Erwiniaceae; Erwinia.
Sequence
MAIHHYKSKAAHLAVMAELAWREYNVAMPEIDIGDDIFAVKDSSGNMWRLQVKYSQAKKL
KKGYSGTFGVRHDQLVKPTSPELYYVFVIKKECGNWFYLILPRQALETHFTSNKFGHVFF
NKSLKKEVINFHVFFNDNGEVSYSTGSKKKFLTDYLNNWGKIPAI
Download sequence
Identical sequences A0A014PTG5
WP_034940317.1.3328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]