SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015IAT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015IAT0
Domain Number 1 Region: 33-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-22
Family Trypanosoma sialidase, C-terminal domain 0.09
Further Details:      
 
Domain Number 2 Region: 253-361
Classification Level Classification E-value
Superfamily MIR domain 9.68e-17
Family MIR domain 0.0076
Further Details:      
 
Domain Number 3 Region: 186-281
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000471
Family MIR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015IAT0
Sequence length 366
Comment (tr|A0A015IAT0|A0A015IAT0_9GLOM) Pmt1p {ECO:0000313|EMBL:EXX54317.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_235680 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MPKFAVREWAELISDPISMGEQDKRIFEHADLPSVNDKLSITLRLKINKHRSNWATIFHK
GAESSDCTPSLWLTKNNSALTPRFKGNWSNYVGFSEIGDGLILDKWHHIAYTLSDLEKRL
DIYVDGEWIGFYSIPIVKDQRVIFNDGPLHIGCAHNYYGFIGEISNFRYFNWRLSAEEVK
EDFFNESQKKPIVCGSKIALVHVSTRKYLSTKGVKYDFAPKNKHYMVICSGQEIDLKNDV
WTVIGANGKSINEGDLISLNNIIGFRHQETGCYLHSHNTSYERVTPISKLQQVTLCSDRC
MDDNWLIRRYNSITSYDTGHLMNGDIICLFHINTNKQALYSHTVLLGDESQEVSCYGDGS
ENNNKV
Download sequence
Identical sequences A0A015IAT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]