SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015J8L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015J8L7
Domain Number 1 Region: 158-264
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000837
Family MIR domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015J8L7
Sequence length 345
Comment (tr|A0A015J8L7|A0A015J8L7_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX63215.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_154320 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MELQKYDGNIHPDEWINDLRTYFNINPSSKDVIIAISLVDPTIKLSTDINSFEKLRNELK
EDSSFTVFKNANKRKLQLLKYIPGCDTLKFVTTFRKLCYNGEINNIEEQKKYLFKTLPIS
NFNDISNEFHVKMKNVSSLNELIKEFEDIILEKSNIIKSGSVVALKHVATGKYLSSIKNL
HYTTGSKKQLVFAGSSDFNLNSLWNIEFNGEFATSFDTFALRHIKSSLFLGINWGYSRSY
YKSPSTNHTEVSCDGNETKWNFRHSKLENDQVYLKSNDIINLGIEKKYDYDGNKILDGPT
EFLRSHDIQFTIRNDAFQEVVCHNERLGGNDVWCIEFIKEHTWSA
Download sequence
Identical sequences A0A015J8L7 A0A2H5TT76 A0A2I1E6R3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]