SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015JFD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015JFD3
Domain Number 1 Region: 61-231
Classification Level Classification E-value
Superfamily MIR domain 7.85e-17
Family MIR domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015JFD3
Sequence length 247
Comment (tr|A0A015JFD3|A0A015JFD3_9GLOM) Pmt1p {ECO:0000313|EMBL:EXX65800.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_129790 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MGTTENSEDVGNSEEKNIFIQPTTTQESSLQIQNFSHFQPQTSIPPGSSNSSSTTDEYIR
FGSCIALQHSTTSRHLSSRSPDNKESSKGNKDQVFATRRKSENELWMVLQAYGERRRLKK
GDAVPYNAQIRLGHIVSRRNLRSHPDYISPISNQQEVICHDENTSDLNDNWLVQRHSYTN
HYDNSGYWLADDAITLRHIQTGATLHSHSIMLDNDDNQEVTCYGPGHEENDKWKAEHNDI
NDFIRSS
Download sequence
Identical sequences A0A015JFD3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]