SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015JMX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015JMX5
Domain Number - Region: 17-85
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0549
Family Capz alpha-1 subunit 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015JMX5
Sequence length 93
Comment (tr|A0A015JMX5|A0A015JMX5_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX70867.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_083640 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MKTLYESENPACEPSNNCNIHLISKCNEEIDSRYCILDFDLANREVFDFVDLNLYISNDS
IKKYNFICDIQLSVSTGLYRYPHGNYLGILNFI
Download sequence
Identical sequences A0A015JMX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]