SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015JZW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015JZW8
Domain Number 1 Region: 3-164
Classification Level Classification E-value
Superfamily MIR domain 3.4e-44
Family MIR domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015JZW8
Sequence length 172
Comment (tr|A0A015JZW8|A0A015JZW8_9GLOM) Pmt1p {ECO:0000313|EMBL:EXX52706.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_250720 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MTHIPSSYKLHSHSVAYGRGSGQQSVTGLPDADDPESLWIIKGAHGESCPRGEPIECGSV
IRLKHSGTNKFLHSHHHRSPISKQQEVSAFDGLDTGDNWKVICLDKSTTYWLREQKFQLL
HVETSAYLFANEEYVYNNPISGQIEVSATKKTGENTEWAVQEGIYFADRHYN
Download sequence
Identical sequences A0A015JZW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]