SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015KTM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015KTM4
Domain Number 1 Region: 155-247
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000536
Family MIR domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015KTM4
Sequence length 380
Comment (tr|A0A015KTM4|A0A015KTM4_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX63221.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_154380 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MNSFPKYDGSIHPDEWINDIKKYYNMWEDNYGGFLHTAKSLINSTIKLPTEINDLEKLRG
ALKKDISFTVFKASNKRKLQSLNSLNYSGDILKFFTDFRNLCYNSETDDIEEQKEYFYAS
LNDNRYFLTEFYKRMKNINSMDELIKAFEEIELNIIRQGSIVALKHVATGKYLTSIKDFC
YTTGSKKQLVFTGNSKFDPNALWKIRSRSNDEYGYIKTDLRLQHLSSNHYLGIRYRQYQI
EIQNQYQNTFQNQSPFQYQYQYRSVANSPIQKQYKNQYEYHKSPSSNHTEVSCGEDDYTW
NFKHSNLENYEGYLKPNDIVNLSIKKSFDINGPIQDGQVEFLRNHDVQFTIGNDIFQEVI
CHNERLGGIDEWCIELIKRA
Download sequence
Identical sequences A0A015KTM4 A0A2I1E6R8 U9T5D0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]