SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015LFQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015LFQ0
Domain Number 1 Region: 82-194
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000000183
Family MIR domain 0.014
Further Details:      
 
Domain Number 2 Region: 25-104
Classification Level Classification E-value
Superfamily MIR domain 0.0000000706
Family MIR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015LFQ0
Sequence length 195
Comment (tr|A0A015LFQ0|A0A015LFQ0_9GLOM) Pmt1p {ECO:0000313|EMBL:EXX71401.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_078930 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MKHEGYFHSDYRNLLLTGYFFPGTVYTGKYLATKGIKYDFGQKDQQYMVVCSGHKIDFKN
NVWTVIGASDQSIKEGDLISLNKIIGLKHHEIGYYLHSHGTSNHENVTPISKQQQVTICS
DRGIDNDWLIQRYNFTTSYDVGHLMNGDIVSLYHINTNKPALYSNTVLLGDGSQEVSCYG
DGSEKNNKWRIELIN
Download sequence
Identical sequences A0A015LFQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]