SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015LHH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015LHH9
Domain Number 1 Region: 32-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-21
Family Trypanosoma sialidase, C-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 195-343
Classification Level Classification E-value
Superfamily MIR domain 4.27e-17
Family MIR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015LHH9
Sequence length 375
Comment (tr|A0A015LHH9|A0A015LHH9_9GLOM) Pmt1p {ECO:0000313|EMBL:EXX54318.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_235690 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MMPKFSVREWAELISEPISMEEQDQRVIEHAHLPAVNDKLSITLRLKIHKHYPDWTAIFY
KGADSSARTPSLWLTKNKSTLFPRFTGNWDHNVGINSLGNGFSLNKWYHIAYTLSDPEKR
LDIYVDGEWIRFYGIMSVKDQKVVFNDGPLLIGRAYNYHGFSGEIRNVRYFNWRLSVEEV
MEDFFNESQKKPIVYGSKIALIHVSTEKYLSTKRIKYDLGSQNKQYMVICNGQEIDLKND
VWIVIGANDKGINEGDLVSLNNIIGFKHQATGCYLHSHDTNNHERVTPISKQQQVTMCSD
RSFDDDWLIRRYNLTTSYDTGHLMSGDIIDLFHINTNKSALYSHAVLLGDESQEVSCYGD
GSEKNNKLQILFNSK
Download sequence
Identical sequences A0A015LHH9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]