SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015LI99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015LI99
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily MIR domain 0.000000876
Family MIR domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015LI99
Sequence length 70
Comment (tr|A0A015LI99|A0A015LI99_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX72391.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_069790 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MAQRINYTKYDSSYVRSGDIINIRNVKDNSFLRSHEYQITIYNENFQEVISQDKKPEEND
EWCIELIENH
Download sequence
Identical sequences A0A015LI99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]