SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015LP07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015LP07
Domain Number - Region: 23-64
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.00288
Family Troponin I 0.088
Further Details:      
 
Domain Number - Region: 62-101
Classification Level Classification E-value
Superfamily Baseplate structural protein gp8 0.0248
Family Baseplate structural protein gp8 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015LP07
Sequence length 116
Comment (tr|A0A015LP07|A0A015LP07_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX74466.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_050820 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MSSKSRQKQPTFKAVAANDDLKYKRKYKELKKKIREMEEENEKLSLKLTRAKKNIQRLKI
ERSFLFDRLEQSQPTNESESDTTSSPPRAIDSEEDLSSVGSDSNDDNGSHAISMKQ
Download sequence
Identical sequences A0A015LP07 A0A2I1DWX7 U9TX70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]