SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015NAG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015NAG3
Domain Number - Region: 166-195
Classification Level Classification E-value
Superfamily MIR domain 0.000124
Family MIR domain 0.016
Further Details:      
 
Domain Number - Region: 51-111
Classification Level Classification E-value
Superfamily Bromodomain 0.00973
Family Bromodomain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015NAG3
Sequence length 215
Comment (tr|A0A015NAG3|A0A015NAG3_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX76188.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_035360 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MDIIKYNATIHPDEWVKYVWTKCLIHKIKEEKEILQLCKLNITINLKTEPKTLDDLIEIL
KAHPTFDIFKICSKEKLDKMKFEDYKNDDTAQFLADFRLLCENTEIINPREIKSRLLKTN
LSNKFFNNEFSRRTSDVTSIDEIYKIYSEVVADSTKIIKYGPEFLISIKHIETGRYLSSR
QINYETGSQRQVVSIFLLLKFISIFTADNHCYYLL
Download sequence
Identical sequences A0A015NAG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]