SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A015QUQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015QUQ9
Domain Number - Region: 60-235
Classification Level Classification E-value
Superfamily NHL repeat 0.0549
Family NHL repeat 0.0074
Further Details:      
 
Domain Number - Region: 276-319
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0942
Family Capz beta-1 subunit 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015QUQ9
Sequence length 372
Comment (tr|A0A015QUQ9|A0A015QUQ9_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXY29093.1} KW=Complete proteome OX=1339284 OS=Bacteroides fragilis str. 3397 T10. GN=M080_0469 OC=Bacteroides.
Sequence
MERRTTDPYINGATRVINIPEDYEQNICSDALFESVDLVPLETTEECLIGRVDRLLICDS
LYLINDTRQRVLVFDRTGKFRYQIGKRGGAPNEYLEVRDFLINDKSELEILDFKKILRYS
LTGEFIGDTRFDYLSDENLYCNPSFFVASPIAGYYLWGSGMGSCKAGDGNCLMYKTDEEM
KIERGYFPIGRGADGNHYRFSKYDKRILIDPIFGDYNIYQIDSLDNLSARYVFDFGNKAC
KRDLDCSDMMSATVQKGLDESVVALYNFQETNKWLHLDFVYKGNVYSLFYSKTNDEVSVV
DIKGCQLENKNSFGFWGAIGVEGEALVNAVEASWVKAEVGRLNPVVVEKLGLNKWNSIQE
SDNPVLAFYRFK
Download sequence
Identical sequences A0A015QUQ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]