SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015TPS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015TPS3
Domain Number - Region: 19-72
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.00114
Family Surp module (SWAP domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015TPS3
Sequence length 99
Comment (tr|A0A015TPS3|A0A015TPS3_BACFG) HIRAN domain protein {ECO:0000313|EMBL:EXY84462.1} KW=Complete proteome OX=1339283 OS=Bacteroides fragilis str. 3996 N(B) 6. GN=M079_2355 OC=Bacteroides.
Sequence
MRYQALTGFDIGVHEGYAKAELNNRYDKYAVGVYREGDHKLMGYVRREQNRELYEFMLNN
NCIAKAKFRIWIHQGEIYGAAYIKEEWKSSLGFKSDIKI
Download sequence
Identical sequences A0A015TPS3 A0A016FMK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]