SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015U2B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015U2B4
Domain Number 1 Region: 49-227
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 9.68e-32
Family Protein prenylyltransferase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015U2B4
Sequence length 256
Comment (tr|A0A015U2B4|A0A015U2B4_BACFG) TPR repeat family protein {ECO:0000313|EMBL:EXY90859.1} KW=Complete proteome OX=1339316 OS=Bacteroides fragilis str. 3998T(B)3. GN=M125_2424 OC=Bacteroides.
Sequence
MKNIILIILVLLSSCGFSQRQNNWRDGHVELDSIPLTAYEYKERGKRKSANGDKQGAIDD
YTRAIMVEPTYDTAYHNRGVVRADIGYYKDAILDYTKAIEINPHFAASYFSRANAKVDLR
DNKGALSDYSKAIELNPRFIDPYVNRGVLKSEMGDYEGEIADYHLAIKHCEPSVNLYNNL
GRALYALERFKESAEAYGEGIKYFPEDYRLYYGRGLARKRTGDKKGACEDWMKSSELGCV
EANLLLPLCKECDTKK
Download sequence
Identical sequences A0A015U2B4 A0A0E2AE68 A0A0E2TD98 A0A1C0WUD3
WP_005787063.1.10405 WP_005787063.1.18542 WP_005787063.1.21908 WP_005787063.1.26260 WP_005787063.1.37052 WP_005787063.1.38746 WP_005787063.1.39779 WP_005787063.1.456 WP_005787063.1.53885 WP_005787063.1.56204 WP_005787063.1.57121 WP_005787063.1.60854 WP_005787063.1.69826 WP_005787063.1.7580 WP_005787063.1.85293 WP_005787063.1.9461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]