SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015ZX10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015ZX10
Domain Number - Region: 11-130
Classification Level Classification E-value
Superfamily Chondroitin AC/alginate lyase 0.0833
Family Hyaluronate lyase-like catalytic, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015ZX10
Sequence length 188
Comment (tr|A0A015ZX10|A0A015ZX10_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ20971.1} KW=Complete proteome OX=1339271 OS=Bacteroides fragilis str. J-143-4. GN=M067_0521 OC=Bacteroides.
Sequence
MDKLDNDYLVYTNYDKKADFKQFSTYYIPDSVLVIGDKKDPEYWKGEAAEAIINAYKENL
NNKGFTYTDNKDAADLGIQVSYVQSTYYFTDYGQPEWWWNYPGYWDAPYWGNWGGWYYPY
VVNYSITTNSFLTEIMNLKAPEGEKQKLPVLWSSFLSGPASYSGKVNQTLVVRAINQSFA
QSPYLTNK
Download sequence
Identical sequences A0A015ZX10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]