SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A016I3R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016I3R3
Domain Number 1 Region: 798-1179
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.78e-129
Family PFOR PP module 0.00000000679
Further Details:      
 
Domain Number 2 Region: 417-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.11e-81
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000239
Further Details:      
 
Domain Number 3 Region: 6-260
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.12e-76
Family PFOR Pyr module 0.000000015
Further Details:      
 
Domain Number 4 Region: 261-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.63e-51
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000128
Further Details:      
 
Domain Number 5 Region: 670-831
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.78e-17
Family Ferredoxin domains from multidomain proteins 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016I3R3
Sequence length 1184
Comment (tr|A0A016I3R3|A0A016I3R3_BACFG) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome OX=1339337 OS=Bacteroides fragilis str. 1007-1-F #3. GN=M146_1443 OC=Bacteroides.
Sequence
MTKQKKFITCDGNQAAAHISYMFSEVAAIYPITPSSTMAEYVDEWAAAGRKNIFGETVLV
QEMQSEGGAAGAVHGSLQAGALTTTYTASQGLLLMIPNMYKIAGEFLPCVFHVSARTLAS
HALCIFGDHQDVMSARQTGFAMLAEGSVQEVMDLAGVAHLATIKARVPFMNFFDGFRTSH
EIQKIEMLENEDLAPLVDQEALAEFRARALNPMNPVARGMAENPDHFFQHRESCNNYYEA
VPAIVEEYMNEISKITGRKYGLFDYYGAEDAERVIIAMGSVTEAAREAIDYLTSQGEKVG
LVAVHLYRPFSAKHFLAAVPKTAKTIAVLDRTKEPGANGEPLYLDVKDCFYGAENAPVIV
GGRYGLGSKDTTPAQIIAVFKNLAMPMPKNHFTIGIVDDVTFTSLPQEAEIALGGEGMFE
AKFYGLGADGTVGANKNSVKIIGDNTDKHCQAYFSYDSKKSGGFTCSHLRFGDDPIRSTY
LVNTPNFVACHVQAYLHMYDVTRGLRKNGSFLLNTIWEGEELAKNLPNKVKKYFAQNNIS
VYYINATQIAQEIGLGNRTNTILQSAFFRITGVIPVDQAVEQMKKFIVKSYGKKGEDVVN
KNYAAVDRGGEYKTLTVDPAWANLPDDAKVENNDPAFINEVVRPINAQDGDLLPVSAFKG
IEDGTWYQGTSKYEKRGVAAFVPEWNAENCIQCNKCAYVCPHASIRPFVLDAEEQKGANF
EMLKAVGKQFDGMTFRIQVDVLDCLGCGNCADICPGNPKKGGKALTMKHLESQLAQADNW
TYCADNVKSKQHLVDIKANVKNSQFATPLFEFSGACSGCGETPYVKLISQLYGDREMVAN
ATGCSSIYSGSVPSTPYTTNAKGHGPAWANSLFEDFCEFGLGMELANEKMRARIVKLFNE
ILAADNAPAEAKEVLKAWIENMYDADKTKELAPQIEAIIEQGIAAGCPISKELKGLTQYL
VKRSQWIIGGDGASYDIGYGGLDHVIASGKDVNILVLDTEVYSNTGGQSSKATPVGAIAK
FAASGKRVRKKDLGLMATTYGYVYVAQIAMGADQAQTLKAIREAEAYPGPSLIIAYAPCI
NHGLKAGMGKSQEEEEKAVKCGYWHLWRYNPALEAEGKNPFTLDSKEPNWDDFKGFLKGE
VRYASVMKQYPAEAEELFQAAEDNAKWRYNNYKRLANQAWGAAE
Download sequence
Identical sequences A0A015RY37 A0A015SN14 A0A015TMD5 A0A015TZ28 A0A015X7Q5 A0A015YB00 A0A016CM96 A0A016DG11 A0A016ED91 A0A016I3R3 A0A017N5E4 A0A017NCI1 A0A0E2ACF5 A0A0E2AKN4 A0A0E2RIV3 A0A0E2T9G1 A0A0E2TAC0 A0A0K6BWL1 A0A139TCK3 D1JSK8 E1WU33 F7LUG5 I9BCS8 K1FXS7 Q5LAL0 Q64R05 R6YS89
gi|375359433|ref|YP_005112205.1| gi|60682637|ref|YP_212781.1| gi|53714618|ref|YP_100610.1| WP_005789619.1.10040 WP_005789619.1.100686 WP_005789619.1.10083 WP_005789619.1.101046 WP_005789619.1.10405 WP_005789619.1.11335 WP_005789619.1.15557 WP_005789619.1.18542 WP_005789619.1.2011 WP_005789619.1.21107 WP_005789619.1.21713 WP_005789619.1.21908 WP_005789619.1.22050 WP_005789619.1.23698 WP_005789619.1.26260 WP_005789619.1.26832 WP_005789619.1.26934 WP_005789619.1.30158 WP_005789619.1.30608 WP_005789619.1.31541 WP_005789619.1.32651 WP_005789619.1.33107 WP_005789619.1.34692 WP_005789619.1.35533 WP_005789619.1.36984 WP_005789619.1.37052 WP_005789619.1.37988 WP_005789619.1.38746 WP_005789619.1.39779 WP_005789619.1.40326 WP_005789619.1.4066 WP_005789619.1.42362 WP_005789619.1.43770 WP_005789619.1.44936 WP_005789619.1.456 WP_005789619.1.46679 WP_005789619.1.49420 WP_005789619.1.49748 WP_005789619.1.50677 WP_005789619.1.50935 WP_005789619.1.51373 WP_005789619.1.5142 WP_005789619.1.51489 WP_005789619.1.51763 WP_005789619.1.52936 WP_005789619.1.53885 WP_005789619.1.53910 WP_005789619.1.53995 WP_005789619.1.54019 WP_005789619.1.55270 WP_005789619.1.56204 WP_005789619.1.58084 WP_005789619.1.60854 WP_005789619.1.6251 WP_005789619.1.63108 WP_005789619.1.63590 WP_005789619.1.63925 WP_005789619.1.65409 WP_005789619.1.65726 WP_005789619.1.65921 WP_005789619.1.66858 WP_005789619.1.66941 WP_005789619.1.73957 WP_005789619.1.75668 WP_005789619.1.7580 WP_005789619.1.85293 WP_005789619.1.87523 WP_005789619.1.88754 WP_005789619.1.89499 WP_005789619.1.89819 WP_005789619.1.91045 WP_005789619.1.91849 WP_005789619.1.93484 WP_005789619.1.93759 WP_005789619.1.9461 WP_005789619.1.94953 WP_005789619.1.95091 WP_005789619.1.95750 WP_005789619.1.97349 WP_005789619.1.97964 WP_005789619.1.98903 YP_100610.1.45732 272559.BF3168 295405.BF3332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]