SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016QST4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016QST4
Domain Number 1 Region: 1-246
Classification Level Classification E-value
Superfamily Folate-binding domain 2.13e-86
Family Aminomethyltransferase folate-binding domain 0.00000236
Further Details:      
 
Domain Number 2 Region: 250-331
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.05e-20
Family Aminomethyltransferase beta-barrel domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016QST4
Sequence length 332
Comment (tr|A0A016QST4|A0A016QST4_9DEIO) Glycine cleavage system T protein {ECO:0000313|EMBL:EYB68864.1} KW=Complete proteome OX=1476583 OS=Deinococcus phoenicis. GN=DEIPH_ctg016orf0010 OC=Deinococcaceae; Deinococcus.
Sequence
MVPFGGWDMPVQYAGVKAEHDAVRTRAGMFDVSHMGEFRVTGPDAEAFLQRVTTNDVMKL
RPGRAQYNWLPNDAGGLVDDIYVYRIGEQEFLLVVNASNIGKDWAHLQAHAAGLGVQLSD
ESDQWGLLAVQGPEAAALLQPHLDVDLAAKKKNAYFPARLFGQDVWLARTGYTGEDGFEV
FVAAERTEALWDNLLALGLTPAGLGARDTLRLEAGFPLYGHEFADDLHPLASTYTWVVKD
KEHVGRAGIQAAPPVKLIGLALERVPVREGYPVLLGGERVGRVTSGSSSPTLGHPIAMAL
VNADAATADAYEVEVRGKAHPARRVELPFYKR
Download sequence
Identical sequences A0A016QST4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]