SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016TDT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016TDT3
Domain Number 1 Region: 24-98
Classification Level Classification E-value
Superfamily Serine protease inhibitors 3.27e-25
Family ATI-like 0.00064
Further Details:      
 
Weak hits

Sequence:  A0A016TDT3
Domain Number - Region: 103-128
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000536
Family ATI-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016TDT3
Sequence length 153
Comment (tr|A0A016TDT3|A0A016TDT3_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC00852.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0112g298 OC=Ancylostoma.
Sequence
MRALYRIPVWLFFIWQCNGKSIKPTKECGSNEYYDSCGGQDCEPTCQEPDRVCRSRACFG
PAYCACKKGFYRNKDGECVSEDDCEYDNMEIITFPPETTKGPKNCGVHEYYDYCGNECEP
TCEEPVKVRQPYETEEKTLTSLKVDASVCIQSN
Download sequence
Identical sequences A0A016TDT3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]