SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A016UP12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016UP12
Domain Number 1 Region: 35-114
Classification Level Classification E-value
Superfamily MIR domain 1.83e-20
Family MIR domain 0.0000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016UP12
Sequence length 122
Comment (tr|A0A016UP12|A0A016UP12_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC16661.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0033g2770 OC=Ancylostoma.
Sequence
MNPGPGSCFQPKKGLRPKERWAHIKFVPTTSRNPSPSEVSCFGNDAQSDTGDNWQVVCDT
EEWLETEPVKFKHVDTGVYLALSGQQFGRPIHGQREVVGTDGATSGGKWKAAEGVFMKRN
KE
Download sequence
Identical sequences A0A016UP12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]