SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016V283 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016V283
Domain Number 1 Region: 374-457
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 3.27e-17
Family Lamin A/C globular tail domain 0.0018
Further Details:      
 
Domain Number 2 Region: 21-56
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000418
Family Intermediate filament protein, coiled coil region 0.0037
Further Details:      
 
Weak hits

Sequence:  A0A016V283
Domain Number - Region: 259-326
Classification Level Classification E-value
Superfamily SPOC domain-like 0.0141
Family Ku70 subunit middle domain 0.015
Further Details:      
 
Domain Number - Region: 122-196
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016V283
Sequence length 501
Comment (tr|A0A016V283|A0A016V283_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC20853.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0020g105 OC=Ancylostoma.
Sequence
MNHDFPSGRSRFGETNAFYPHEKADFQDLNSRLERYISLVKGLERDNAQLVNELRHLHES
WGQQNTEYKSSFSKSLLLNRDESVAALKNSAEQSIRAKRINANIDLLNRRIEGIRLAEQG
DRARCAELRSQISKAEADLELQMRENGRLADERAQLTAQNAGLYNDYERIWDEIDRIRLE
LAEYQAREERLLAEKEFLLKVQEREVYEINNLLAESSFDARKFFENDIALAIKDIKLEYE
ASHKIIRSNVTSYYHQKLDEMRKLAESKSSDETKYRRDQIAKMENMIGDLKQKFRPLEDR
NHMLENEYKQLQNSMKNDEDRYEAEKRRRDDEYKNALAMYQRLLMEQGSMSEVTLLELEI
YRKMIECEEKRWGSRDFVNVQESFSQITKHRTYAGDIRIKDCDEHGKYVIIENAGHSDHR
LSGYRISRTVAGNERSFTFPALFVLGPGQTVQVGFQKLHVLRKTSHKDGISLREKHCEGK
GAVSLFCYWLFPRSFTGESVE
Download sequence
Identical sequences A0A016V283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]