SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016VGJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016VGJ4
Domain Number - Region: 35-115
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0693
Family V-type ATPase subunit E 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016VGJ4
Sequence length 189
Comment (tr|A0A016VGJ4|A0A016VGJ4_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC25878.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0011g1438 OC=Ancylostoma.
Sequence
MIHEEQRLVEEENRMNALKTRWKSSGCGRGLTLTRQLHKSAYRRLLFVTTTQLRATLEAL
ASEFSAIDFRKPFTVELRDRGSDLLESQAQSITVHAGYLLKENTSSYGGNQFVLRCRDGV
IVDGSDVRLSRRVHRSCCYRDLAPAEHPSNFLNVGQYVNNEPGQQLHIVQYVDFVIHRWP
ADVSSICCV
Download sequence
Identical sequences A0A016VGJ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]