SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A016VNU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016VNU1
Domain Number 1 Region: 505-530,587-620
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000161
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016VNU1
Sequence length 717
Comment (tr|A0A016VNU1|A0A016VNU1_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC28707.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0007g3374 OC=Ancylostoma.
Sequence
MDSISLLGPPQQPKVLNQDDFDSRFNFVRHRKRRTNREILRRMIVENFRDYRNVNDALPF
LAWIRNYDVKASCLRDFLGSLLLAALLIPQGIANGFLAMDVFSGMFSILLPHLIYPFLGS
ARHCSLGSLSMTSFLIYSSVKYTGSSISTVTLCCGVFQLLHFFLPLDFLLSFVSSNLLLG
FSTGVAFRIIWHLVPSIFEFSSEECNYFTRQWNFICFQCAGSAVSCVQSLNIRPPLIFFT
VLIVLLIFKWKLNAVLTSRIGTTIPHELLVMILLAIISYFADFPESESLVSYLESRTFMF
SPPSLPSIQTLLDSYAIFLFSLCAHIKVVSSAEKVQKSKTKQKFFCFSLISLIGSPFGLL
PPFSGRDGSQVCNEARNFSLLSNLLSTIWMAPLLYFGQSTVIRLIPQSAVIALIIASISD
FWTDLRHLRVLFLSHVCDAVISTCALLAAVIIPNLCVAFLVSVACALLSISLRTHWPDCE
VLVRVADNYFAEEKRYEGECPDSPLRIVRLSSPLIFINCETVRRAIQEQAVAVKKLIGIG
IGSRTPSIRSHVQAGPRESLVARSSNNLTNIIITTQDSDIQQIPSSESAALRFIILDCSG
VAYVDPEAVAMLTQEYSGFGRRAAATLAVVHIDRGRGVAGVGRRRRRCRRQQRPTIAAVV
DNGDRPSPLSSTTATDRRRCRRQQRPTVAAVVDTPSSIPIDDSDDDRGDRGRFFALK
Download sequence
Identical sequences A0A016VNU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]