SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A016VUU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016VUU4
Domain Number 1 Region: 497-668
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.09e-43
Family IP3 receptor type 1 binding core, domain 2 0.00000942
Further Details:      
 
Domain Number 2 Region: 273-495
Classification Level Classification E-value
Superfamily MIR domain 1.83e-42
Family MIR domain 0.0000301
Further Details:      
 
Domain Number 3 Region: 1237-1394
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.71e-23
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 135-217
Classification Level Classification E-value
Superfamily MIR domain 0.0000000129
Family MIR domain 0.019
Further Details:      
 
Weak hits

Sequence:  A0A016VUU4
Domain Number - Region: 1231-1361,1401-1573
Classification Level Classification E-value
Superfamily ARM repeat 0.0111
Family Armadillo repeat 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016VUU4
Sequence length 2004
Comment (tr|A0A016VUU4|A0A016VUU4_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC31379.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0004g2123 OC=Ancylostoma.
Sequence
MYSVRTFSSMSFPFLRKSSMGMSMDSGNTSFLHFGDIISLYTEETADLRGFLSTLGLVDD
RCIVELRDGRPESPPKKFRDCLFKVCPVNRYAAQKQFWTEQKRFLSGESTFDDDMMHKLR
IAAEKEKEQNELEFRKTQGNVIQYGTTVQLLHVKSDKYVTVQKNSPAKCERNAMKVYLDR
AGNEGSWFIIEPAYKHYVIGDSVAAGNKISLIPYSVNNQPSAGHVKHQLHLSHCLLKDHQ
TAAEVNCLNESTEWQVYMFLLFNENQPDIVKSGDVVRLFHADQQTFLTLDSVPKTCPPQD
VVFLRMTNRPSAADATSSRALWEVQVVQKDAYRGGAAKWREYYRFKHLATDMYLTAVPAT
SPVKPATNGRRASLMHMKTKAEFLAPPALYADGPESTDECSSSSTFFLVPVKSDFPEADK
KLLFCLDPGTMPKNKDVPTKSYVRLQHDATNTWVHATNASEKQNLYYSSKNEKGWVRVIC
ENSRVDKETFALLPVSPNEVRDLDFANDACRALRNFIRHIKSGDPVTKESINVTIQLLIE
CIFFVTNTTNHMMDPLQINDFSPSRDRQKLLREQEVLDQVFQLLKAPFMPRQGVTEIGPL
LSSPSDLSEQRNEVFKTMFQLCYSLLRYSQVSYRKNQEFLAEKFGQIQEQIGFDLLAEDT
MTAVLHNNPKLLEKYVKTPHIERFVELVRNNRLGKFLDYLADLCVCRGEANKKVQELICN
SVLSERHRDIFMETKLINDEVHIGWMGQQPRRLVDLAESATYSTADAEFLDYYRHQLDLL
AQMCQEQQYLAIDPPPERKLLNISQQLPAELVLKCMSDARLPSEVRASFTRLMLHLHVVR
GSPLSAIRHARLWADIPNEVKVQSYKTTSVEGYSDGGRARVGDQFATDVLNTVESYLDSL
RHSHPNGPVLHKDAASVCTNKLTHEMVTLAKALAQFGYYTFDDLLTLTENLLNIVDTSPH
SAQTARTVSHGMTMIHRVTQSMIGGRPRMADGHSKSVEKTSIEDTVKAKESRQLLVKTKL
IVAEILQFVMDVRRDYRITMALSWFKQNFPCDEHGVLNHTANINERMAHELYEAIYQSSG
HELHLDGGDGQLLLAILMQMTMSDYPPLTSIALKVLFRHFTQYQELLEDLKQVQLLVSSD
DVENYRQVDRDLFILKNLTEKSELWVHGDRHHSIDGKEHDKDEKTLLTMERIVGLIHHVH
DWRDKANEWLRTKMDFEEHELNNSKGFATDESLKAVVDIIDEHYPNNRKECLRLLNQLLI
SEDRNLAAAALQELSDRTPLIAYPLIRQILVRLKKLCYKKDRPDGMNQQLLKNMRVYEVV
LEFLSIPYDKKNDAEMPKLITLSHEFLRSFCKGNKENQSRLHKFISIEKDSKEGTLRVET
EEEAATLVAIFRNNRELASNVSEDLVAHIVNLIEHKSRNAVFLELLQSFVCIHDKEIETS
QDKVATEICTASDEVRALYVDNASFEQLDQMMQNAPPYLDNTHPLKYHIELVRLLAMCTR
GKNGSTELKCASEIPMDHIVRVVTSPSCLIEVKVAYFQFLLHCYIDTDAEMKDAYKPEYV
DSLLHNMLKDVEKLQNELAKKTTSSSCAVLEQYICLTVTEILLKFFEKPYSEQAKVDIHA
HKKMFTSLLQHLSMLHAGSLKRSQSPKHWYRVDQCIKRLRKWAEENNIALPASVVMPPFS
TVPTVKQRWQCAANSARFIGQQTLTMRNRANSLMMPGFPNPNNHNEKVANVVTCYHMMIG
EFKFYLLPLHSAEGSVLVDVLHTPDLLFPVGSSLREKCAKGGVVTKLIQHCKTLMQNKQD
NLCTRVLQTLCRMCNGSRQNLSEQPIEFLLPLVDDPLQDFFNGQKLRSKLLQRYFGPHGH
LERQQSLSDGMDGIKSANQTEKEYEVAMEERSLYDIQCRLNEAGASDLVIDIIINEPSRE
IFLKAIQLAKALLLEGNDKVQQSFYNRLKKKDTHEPFFTALSHRIQTAQNRLKSDMMSCN
ENKPKGAVDRLAKVVCMRVALEIL
Download sequence
Identical sequences A0A016VUU4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]