SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A016WA15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016WA15
Domain Number - Region: 3-87
Classification Level Classification E-value
Superfamily MIR domain 0.0732
Family MIR domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016WA15
Sequence length 127
Comment (tr|A0A016WA15|A0A016WA15_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC36092.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0934g3106 OC=Ancylostoma.
Sequence
MQVPRLTHAYTWNFLFNSSIPARVKSVQKQCIPMQNDLSCHHHHHTISRNPMQIQLRAHK
KNTIFFVPCMGSAWVLQGYAWVSHKFTIAGIELSIKKTGFRMSTLLLIVQFASFNLMQNT
VIRIPEI
Download sequence
Identical sequences A0A016WA15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]