SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016XK79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016XK79
Domain Number 1 Region: 122-295
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.09e-28
Family Nitrogenase iron protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 18-82
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000000000471
Family GSPII protein E N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016XK79
Sequence length 296
Comment (tr|A0A016XK79|A0A016XK79_9BURK) Chain-length determining protein {ECO:0000313|EMBL:EYC51962.1} KW=Complete proteome OX=1458275 OS=Hylemonella gracilis str. Niagara R. GN=AZ34_13440 OC=Comamonadaceae; Hylemonella.
Sequence
MNLPALIYGQPNPPQGEERRIGEILVAHGRLSPQDAARVINRQKLDQRPFGEVALELKVI
SRSDIEFALSKQFDYPYLIDKDTSLSADLIAAYQPFSQAGENLRAVRSQLMLRWFNNDAQ
RKVLAVVSPGQGDGRSFIAANLAIVFAQHGERTLLIDGDLRSPRARGQHALFKLTGGTGL
SAILAGRAGMEVAQAVPGLPGLVVLPAGAIPPNPQELLGRMSFPRLLTDVSDAFDVILID
TPSGMQYADAEIIASRAGAAMMVTRRNQSLLPDAALLARRLRDDDVALVGAVLNDA
Download sequence
Identical sequences A0A016XK79
WP_035608798.1.79976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]