SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A017HAF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017HAF8
Domain Number 1 Region: 163-273
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.9e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A017HAF8
Sequence length 293
Comment (tr|A0A017HAF8|A0A017HAF8_9RHOB) RsbR, positive regulator of sigma-B {ECO:0000313|EMBL:EYD71108.1} KW=Complete proteome; Reference proteome OX=1122180 OS=Loktanella hongkongensis DSM 17492. GN=Lokhon_02755 OC=Rhodobacteraceae; Loktanella.
Sequence
MTAAPTTEVSRLLSEDFDGVLDAWFATQKRDGVRRPDLFSDRESRRQLSELLRTFSEALG
RIDISEPVDIDTEAWSELRMALSEITLVRTERGVAPWEMTAFMLALKQPVFEKLSEGLAN
TPERLLAEASDFGRVVDAFAMHINEHFIAERDEIIERQRAEMMELSTPVVQLWERVLTIP
LIGTLDSMRAQEVMENLLNSIVEHSAEVVIVDITGVRVVDTQVAQHLLRTAAAVRLMGAE
AIISGISPKIAQTMVELGVDVGEVTTRPSIRAALDEAFRRVGFRISRVEDTRV
Download sequence
Identical sequences A0A017HAF8
WP_017927201.1.16665 WP_017927201.1.36416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]