SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017HIP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017HIP4
Domain Number 1 Region: 17-81
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000000994
Family SPO1678-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017HIP4
Sequence length 117
Comment (tr|A0A017HIP4|A0A017HIP4_9RHOB) Mobile element protein {ECO:0000313|EMBL:EYD74008.1} KW=Complete proteome; Reference proteome OX=442562 OS=Rubellimicrobium mesophilum DSM 19309. GN=Rumeso_04379 OC=Rhodobacteraceae; Rubellimicrobium.
Sequence
MKQTSGPTKTKPSAEATLKDIRRATRRQFGAEEKIRIVLEGLRGEDSIAELCRHEGISSS
MYYGWSKEFLEAGKKRLAGDTARAATSDEVRNLRREAGALKELVADLTLENRLLKKA
Download sequence
Identical sequences A0A017HIP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]