SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017IIK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017IIK5
Domain Number 1 Region: 26-105
Classification Level Classification E-value
Superfamily YdhA-like 2.62e-24
Family YdhA-like 0.0000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017IIK5
Sequence length 107
Comment (tr|A0A017IIK5|A0A017IIK5_ECOLX) Membrane-bound lysozyme inhibitor of C-type lysozyme {ECO:0000313|EMBL:EYD85864.1} KW=Complete proteome OX=1444161 OS=Escherichia coli 1-176-05_S3_C2. GN=AC26_1249 OC=Enterobacteriaceae; Escherichia.
Sequence
MKKLLLICLPVLLTGCGAFNQLVERMQTDTLEYQCDEKPLTVKLNNPRQEVSFVYDNQLI
HLKQGISASGARYTDGIYVFWSKGDEATVYKRDRIVLNNCQLQNPQR
Download sequence
Identical sequences A0A017IIK5 A0A166T5E5 R8YM63 S0U5A3 S0WWW8 T8K725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]