SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A017PL14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017PL14
Domain Number 1 Region: 451-549
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000765
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A017PL14
Sequence length 566
Comment (tr|A0A017PL14|A0A017PL14_BACFG) Sulfate permease family protein {ECO:0000313|EMBL:EYE60857.1} KW=Complete proteome OX=1339318 OS=Bacteroides fragilis str. S6L5. GN=M127_5714 OC=Bacteroides.
Sequence
MKVALSFKHLVPKLYTCIKEGYTFNTLKKDVLAGITVGILAFPFAIAIAIGVGVSPVQGL
LASIIGGFIASALGGSRVLISGPTSAFISILYCISIKYGAEGLFVITLMGGIFLVSFGLA
GLGTFIKYMPYPVVTGLTTGLAVIIFSSQIRDFLGLQMGDSIPSDFIAKWVAYWDHLWTW
DSKAFAVGLFTLLIMIYFRNYKPRYPGVMIAIIVASTLVWLLKIDIPTIGSRYGALPQKI
PLPSLPHLSLTKILQIMPEALTIAVLSGIETLLAAVVADGMTGWRHQSNCQLVAQGIANI
GTSLFAGMPVTGSLSRTAASIKSGATTPIAGLIHSVFICIILLVLAPLTVKIPLTCLAAV
LILIAWNMSEIHHFIHLFTAPKKDVIVLLTVFILTVMTTITSAVQVGMMLAAFLFMKQMS
DLSDVISTAKYFDDDTSSKDDDVFTKSEIPAHTEIYEINGPFFFGIADRLKNLLNEIETP
PKIFILCMSRVPTIDASAMHALEEFFLECDRQGTLLLLAGVKKTPLNDLKRYHLDELIGT
DHIFSNTKSSLLFAQALINLENKASN
Download sequence
Identical sequences A0A017PL14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]