SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017RVW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A017RVW3
Domain Number - Region: 162-248
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.000103
Family V-type ATPase subunit E 0.0068
Further Details:      
 
Domain Number - Region: 60-90
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0392
Family F1F0 ATP synthase subunit B, membrane domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A017RVW3
Sequence length 253
Comment (tr|A0A017RVW3|A0A017RVW3_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:EYE88827.1} KW=Complete proteome; Reference proteome OX=1403537 OS=Fervidicella metallireducens AeB. GN=Q428_06030 OC=Fervidicella.
Sequence
MQSSCKVIKSTNIVNNTLVSPPIMEKVFKNNTEMKLEKDSFNIEEIYSSIIDEAKLKAAE
VLKNAESTAKNIIDSAEASKKEILKKAEESGYQSGYQSGYKDGYNYGINEALEEGEKIKN
QAEEQIKNNLEELKLHIKKTEKEIIKLSVDIAKHIINTELSLNPDAVYKIAEKAITQAVD
KKQVILKVNPGDFNIVKRRKDDLAMYVEDANNIFILADSNIQQGSVIVETPSGFVDASID
NQLVTILKGLLGE
Download sequence
Identical sequences A0A017RVW3
WP_035379060.1.49469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]