SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A017S9Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017S9Z8
Domain Number 1 Region: 3-256
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-86
Family Capz beta-1 subunit 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A017S9Z8
Sequence length 266
Comment (tr|A0A017S9Z8|A0A017S9Z8_9EURO) F-actin capping protein beta subunit {ECO:0000313|EMBL:EYE93616.1} KW=Complete proteome; Reference proteome OX=1388766 OS=Aspergillus ruber CBS 135680. GN=EURHEDRAFT_414019 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MADAQFDSALDLLRRLNPRDTKRNLQAIASVVPDLTEDLLSSVDQPLEVRRCPKTKRDYL
LCDYNRDGDSYRSPWSNEFDPPLDDGTVPSERVRKLEVAANEAFDVYRDLYYEGGVGSVY
FWDLDDGFAGVILLKKGVTPGAKSSGEWDSIHVFEATDRARMSHYKLTSTVILHLSNGNE
TLGEMDLSGNMTRQVEVDLPVESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGE
LRSLAPLSETNRDRAAQLEMIKSLQR
Download sequence
Identical sequences A0A017S9Z8 A0A1L9VS30
jgi|Aspgl1|120850|e_gw1.5.799.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]