SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A017SG44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017SG44
Domain Number 1 Region: 327-515
Classification Level Classification E-value
Superfamily MIR domain 6.8e-50
Family MIR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017SG44
Sequence length 777
Comment (tr|A0A017SG44|A0A017SG44_9EURO) Mannosyltransferase PMTI {ECO:0000313|EMBL:EYE95963.1} KW=Complete proteome; Reference proteome OX=1388766 OS=Aspergillus ruber CBS 135680. GN=EURHEDRAFT_514877 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSGTSPSLRKRGGKKETDYASDDASSPLLAGQGGSDTPKRQSEWSYRLAMAILTVLAFVT
RFWRISYPDEVIFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFALMGWMIGYDGHFLFEN
IGESYIENKVPYVALRAMPATLGALTVPVVFQIMWESGYSLPACVLSAGLVLFDNAHIGE
DRLILMDSTLVIAMALSILCYIRFYKLRHDPFTRKWWKWLLLTGVSLSCVISTKYVGVFT
FITIGGAVVIDLWNLLDIKRPRGALSMFQWSKHFGARLFSLIILPLFFYLFWFQVHFTIL
NRSGPGDDFMTPEFQETLSDNAMAAQSVGIQYFDSITIKHKDTKTLLHSHWEKYPLRYDD
GRISSQGQQVTGYPFNDTNNHWQILPTVPLADGEVHSVKNGDVIQLRHLGTDSILLTHDV
ASPFFPTNQEFTTVTQELADGERHNDTLFEIKIENGKAQQDFRTLSSHFKLIHVPTRVAL
WTHTTPLPDWGFKQAEINGNKNVLQSSNLWYVDSIESLPPDSPRLSKEERKVKQLPFLRK
YLELQRAMFLHNNALTSSHPYASEPFQWPFLLRGVSFWTKESTREQIYFLGNPIGWWIAS
SLLAVFAGIIGADQLSLRRGVDALEEIWGPGTRSRVYNSTGFFYLCWAAHYFPFWLMGRQ
RFLHHYLPAHLASALVAGALVEFIFNLQPIPVNQAITETTDDPSGKSRTAAPRRFVQASE
RMGKKSIVAGWIATLVILGATIYGFWFFAPLTYGTPGLDVAGVNARRWLGYDLHFAK
Download sequence
Identical sequences A0A017SG44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]