SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017SQF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017SQF2
Domain Number 1 Region: 31-154
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 0.000085
Family Histidine-rich actin-binding protein (hisactophilin) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A017SQF2
Sequence length 157
Comment (tr|A0A017SQF2|A0A017SQF2_9EURO) Uncharacterized protein {ECO:0000313|EMBL:EYE99182.1} KW=Complete proteome; Reference proteome OX=1388766 OS=Aspergillus ruber CBS 135680. GN=EURHEDRAFT_399462 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MLEKPVIPNSLAVLVQDKPIPKAKTPPWPGQSFIIRDPKTNLVIALNNGNLRLSSQRTKG
YSEGIHWYCVENDEMWLGFYNSISGAYIGHNNRNQFIATARWHDAWEYFCVREHPDGGYL
LLVKHWGGFLPMKVGKRNNLVVDVGRNSGTAWEFIRV
Download sequence
Identical sequences A0A017SQF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]