SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A017T5A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A017T5A4
Domain Number - Region: 15-63
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0902
Family Anti-sigma factor antagonist SpoIIaa 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A017T5A4
Sequence length 140
Comment (tr|A0A017T5A4|A0A017T5A4_9DELT) Uncharacterized protein {ECO:0000313|EMBL:EYF03741.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_5171 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MMNEHRRPCGAHLVVFEAPDLLVVRFSGVISIDDMQRIVLAAEELTGSQEYRVLYDATYS
GSIAPEVRRWMATIKPSPWFRGAVTFGLAFPQRLVASMLMKAIARLKPHKQPLHICATED
EARAWIDGERRHDVQTEASL
Download sequence
Identical sequences A0A017T5A4
WP_044245291.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]