SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017T6K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A017T6K4
Domain Number - Region: 34-130
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0118
Family Sfri0576-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A017T6K4
Sequence length 142
Comment (tr|A0A017T6K4|A0A017T6K4_9DELT) Uncharacterized protein {ECO:0000313|EMBL:EYF04627.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_4303 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MATRTLVATKHLIVTIDPERALSTFTRLETPFATTEEMVQAVQSAFSLLKQSGGASCGML
LDLRRAPGRNDDPGFEARVTALFTKNRDAFLRFAVVVGTASGRLHVQRIGRQLHAPGDVF
LVEAEALAFLRTGEMPTRGNRR
Download sequence
Identical sequences A0A017T6K4
WP_044243820.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]