SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A021X5H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A021X5H0
Domain Number 1 Region: 173-358
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.45e-72
Family Methylesterase CheB, C-terminal domain 0.000000534
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily CheY-like 3.98e-28
Family CheY-related 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A021X5H0
Sequence length 362
Comment (tr|A0A021X5H0|A0A021X5H0_9RHIZ) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1410620 OS=Shinella sp. DD12. GN=SHLA_33c000740 OC=Rhizobiaceae; Shinella.
Sequence
MVLPGKKIRVLIIDDSASVRQALTHVLEQDPEIEVMGAASDPFMAAKKIQEEVPDVITLD
VEMPRMDGITFLRKLMSQRPIPVVMCSSLTEEGSETLMQALEAGAVDIILKPKIGAADHL
AESGTRIREAVKGAAVARLGQSRRSAAASGPTAKLTADAVLPPPSGRAMAKTTEMVACVG
ASTGGTEALRVLLEQLPANSPGIVIVQHMPEKFTAAFAKRLNSLCEVEVKEAVHGDPVLR
GHVLIAPGDRHMMLERQGARYHVAVREGPLVSRHRPSVDVLFRSAARSAGANAMGVILTG
MGDDGARGMNEMHQAGAYTVAQDEASSIVFGMPKEAIAHGGVDRILPLDQIAREILAADR
RR
Download sequence
Identical sequences A0A021X5H0
WP_023516701.1.102000 WP_023516701.1.37902 WP_023516701.1.59599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]