SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022LEQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022LEQ0
Domain Number 1 Region: 48-169
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 3.53e-42
Family Insert subdomain of RNA polymerase alpha subunit 0.0000487
Further Details:      
 
Domain Number 2 Region: 7-48,170-220
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 2.26e-25
Family RNA polymerase alpha subunit dimerisation domain 0.004
Further Details:      
 
Domain Number 3 Region: 247-317
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.14e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A022LEQ0
Sequence length 329
Comment (tr|A0A022LEQ0|A0A022LEQ0_9MICO) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome OX=1247714 OS=Microbacterium sp. UCD-TDU. GN=D514_0103065 OC=Microbacterium.
Sequence
MLIAQRPTLTEEKIVENRSRFIIEPLEPGFGYTIGNALRRSLLSSIPGAAVTSVRIDGVL
HEFSTIPGVKEDVTEIILNIKQLVVSSERDEPITAYLRKTGSGEVTAADISAPAGVEIQN
PELVIATLNETAKFELELTIERGRGYVSATQNRNEYAEAGQIPIDSIYSPVLKVSYRVDA
TRAGERTDFDKLVLDVETKSAISPRDAVASAAKTLTELFGLARELNVEAEGIEIGPAPVE
AVNSSELSMPIEDLDLSVRSYNCLKREGINTVSELVALSETQLMNIRNFGQKSVDEVRDK
LISLGLSLKDSVPGFDGAHFYGGSEDESF
Download sequence
Identical sequences A0A022LEQ0 A0A0F0KPD0 A0A0Q5FHV5 A0A0Q6PAN0 A0A0Q7S0H9 A0A0Q7VLK7
WP_017829188.1.22985 WP_017829188.1.52462 WP_017829188.1.53258 WP_017829188.1.62897 WP_017829188.1.80091 WP_017829188.1.95610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]