SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022MDQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022MDQ3
Domain Number 1 Region: 14-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-44
Family Extended AAA-ATPase domain 0.0000084
Further Details:      
 
Domain Number 2 Region: 258-353
Classification Level Classification E-value
Superfamily TrpR-like 1.44e-34
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022MDQ3
Sequence length 354
Comment (tr|A0A022MDQ3|A0A022MDQ3_9ACTN) Chromosomal replication initiator protein DnaA {ECO:0000256|RuleBase:RU000577} KW=Complete proteome; Reference proteome OX=1470557 OS=Streptomyces sp. Tu 6176. GN=CF54_27915 OC=Streptomyces.
Sequence
HAAQGHGPGEPTARLNPKYLFDTFVIGASNRFAHAAAVAVAEAPAKAYNPLFIYGESGLG
KTHLLHAIGHYARSLYPGTRVRYVSSEEFTNEFINSIRDGKGDSFRKRYREMDILLVDDI
QFLADKESTQEEFFHTFNTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWGLITDVQPP
ELETRIAILRKKAVQEQLNAPPEVLEFIASRISRNIRELEGALIRVTAFASLNRQPVDLG
LTEIVLKDLIPGGEDSAPEITAPAIMAATADYFGLTVEDLCGTSRGRALVTARQIAMYLC
RELTDLSLPKIGAQFGGRDHTTVMHADRKIRALMAERRSIYNQVTELTNRIKNG
Download sequence
Identical sequences A0A022MDQ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]