SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022MMT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022MMT0
Domain Number 1 Region: 21-125
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-25
Family Anti-sigma factor antagonist SpoIIaa 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022MMT0
Sequence length 126
Comment (tr|A0A022MMT0|A0A022MMT0_9ACTN) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=1470557 OS=Streptomyces sp. Tu 6176. GN=CF54_15580 OC=Streptomyces.
Sequence
MAEGHTTDARAAAQAPQPVGLSVTATTCDDVRVLTLAGEIDHDTGETLRRALDAPGPSRI
AVDMRQVTFMDSSGINLLLNGHQAATAAGGWLRLAAPSPTVLRTLQIVGIDEVIGCHPTL
PDALDH
Download sequence
Identical sequences A0A022MMT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]