SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022PKA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022PKA9
Domain Number 1 Region: 445-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000118
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022PKA9
Sequence length 576
Comment (tr|A0A022PKA9|A0A022PKA9_PHOLU) Sulfate permease-like transporter, MFS superfamily {ECO:0000313|EMBL:EYU16106.1} KW=Complete proteome OX=1393736 OS=Photorhabdus luminescens BA1. GN=BA1DRAFT_01270 OC=Morganellaceae; Photorhabdus.
Sequence
MQWKKLQRWMPGLGNFSHYRKEWFSHDLRAGLSVAAVALPVAIAYAELMGISAIIGLYAC
ILPMFAYALFGTSRQLIVGPDAATCAVIAAAVAPLVFDNEDVRWQLTIVMTLMTGIWCVL
ASHFRLGAFADFLSKPILKGLMNGVALTIIVDQLAKVFGFAGVPAGLIERVIALPAKLMS
THLPTLAMSVATVLILLIVRFLRPTWPGPLLAMVLTTYVSWQFGLEKYGIQIVGGVSGGG
LPVVPMPDFQPGIMRELVIPSLNLAVISFVSFMMTARSFASKNGYQIDADCELRALGIAN
IASALSQGFAVSAASSRTAVNDAIGGKTQLVSVIAATIILLVLLFMTSFLAYIPLSSLGV
VLIYSASSLLDLRRIWSLRKRNHQAFTLSLFTLIAVLVVGLINGVGFAVLLGLLQFLRTI
FRPTDQLLGVNDQGMIHSINHGNDIKPIDGVMMYRFNSPLTYFNVSYFKKRVLQHVDRIQ
KLNKTQKRPGWLVVDAAVSFTHDDVSVFAAIDELINELKVRDITLVLAGRRTELTRWIKQ
NKLQSSDDDLIVAPDLYFAVRMIQSKPEWYSNYAKR
Download sequence
Identical sequences A0A022PKA9
WP_036777125.1.53218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]