SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022RL17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022RL17
Domain Number 1 Region: 521-638
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.65e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022RL17
Sequence length 657
Comment (tr|A0A022RL17|A0A022RL17_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU40896.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a002568mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MGNADHSYDPSFNDNYYGSANHRVEIPPPQPFVKSIKNTLKETFFPDDPLRQFKNQPPRK
KLVLGFQYIFPILEWGPRYTLEFLKADLIAGITIASLAIPQGISYAKLANLPPILGLYSS
FVPPLVYAVMGSSRDLAVGTVAVGSLLTGSMLSEVVSPTDDPKLYLHLAFTATFFAGLFE
ASLGIFRLGFIVDFLSHATIVGFMGGAATVVCLQQLKGILGLDHFTHATDIISVMRSVFT
QTHSWRWESAVLGCVFLFYLLLSRYFSKMKPKLFWVSAMAPLTSVVLGSLLVYFTHAEKH
GVQVIGDLKKGINPASLMDLNFDSRYLTGTIKTGIVTGIIALAEGIAVGRSFAMFKNYHI
DGNKEMIAFGMMNIAGSCTSCYLTAGPFSRSAVNFNAGCKTAVSNLVMAFAVMITLLFLT
PLFYYTPLVVLSSIIVAAMLGLIDYEAAIHLWHVDKFDFLVCMSAYIGVVFANIEIGLGL
AIGLSIMRVLLFVARPKTLVLGNLPDSKVYRSVDQYQNATNVPGVLILEIDSPIYFANSN
YLRERISRWINDEEDKLKSSGETVLQYVVLDMSAVGNIDTSGISMLDEVKKTADRRGLKL
ALVNPGAEVMKKLNKSNFLEKIGQEWIFLTVGEAVGACNYMLHSCNIESQKHSNNIV
Download sequence
Identical sequences A0A022RL17
XP_012833226.1.32330 mgv1a002568m|PACid:17681124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]