SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022RQ95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022RQ95
Domain Number 1 Region: 1-25
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00000811
Family Capz alpha-1 subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022RQ95
Sequence length 37
Comment (tr|A0A022RQ95|A0A022RQ95_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU42181.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a0105711mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
DLRRKLPVTRTLFPWHNTQQFSLTKDIQKSLGLEGSK
Download sequence
Identical sequences A0A022RQ95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]