SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022W0I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022W0I4
Domain Number 1 Region: 42-204
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-47
Family Capz alpha-1 subunit 0.000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022W0I4
Sequence length 212
Comment (tr|A0A022W0I4|A0A022W0I4_TRIRU) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EZF51704.1} KW=Complete proteome OX=1215330 OS=Trichophyton rubrum CBS 288.86. GN=H103_05189 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MLLMIGRYRQPPTPGHMCLNLRTQTSCQLTTAASFAPCKQPMPMLTDPCRKSYLKLLSSH
ASEHYPNSSYGVYPSQDDSSIAILLVANKYSPNNFWNGRYRAIYNVPVSSGGTITGTIHV
DVHYYEDGNVSLNNKKPVSISIPSASPADTAFKRIVTSEREHQEELNDAFNRLAEGAFKG
LRRQLPITRQKVEWEKIGAYRLGKDISGGTGY
Download sequence
Identical sequences A0A022W0I4 A0A022XRL5 F2SLL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]