SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022W4F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A022W4F3
Domain Number - Region: 720-772
Classification Level Classification E-value
Superfamily MIR domain 0.0706
Family MIR domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022W4F3
Sequence length 1067
Comment (tr|A0A022W4F3|A0A022W4F3_TRIRU) Uncharacterized protein {ECO:0000313|EMBL:EZF53016.1} KW=Complete proteome OX=1215330 OS=Trichophyton rubrum CBS 288.86. GN=H103_04001 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MESFDDVALSLKSVAEMGSFSGQSAGCQPQPHEPSDIRRTSFDKAAQRHDDEGLTNIKED
NNSPNSSLADSPATVLNPYDPQRTQGDKNRQTSQQTSNSTSIDNSFEERRGSTSMLIFDD
DGEGGDEEPHVAKSFERTTSPTSAAHKGRDDTDTRSDGSSMGHAGQDGDLPFAKMHKFSL
YETATKYYLVGMDLLDRRFRMLKIDRTSDPEEDLVFAEDETIYSKKEMNQLLDAVDDGNK
SSGGLKLRCSTWGLLGFIRFTGSYYMLVITKRSQVAMLGGHYIYQIDGTELIPLESYTTA
RQRPEKHADEARFVAVMNNIDLTRSFYFSYSYNISRTLQDNIVAERQAIRSEQKNRGNGD
PNSMFVWNQYLLNPVIKLLKNAFDWFLPITHGYVDQSAISIYGRLVYLTLIARRSRFFAG
ARYLKRGVNDLGYVANDVETEQIVSDMLTTSFHAPGPELYANPQYTSYVQHRGSIPLAWT
QDSTGVTPKPDISLSVVDPFYSAAALHFNNLFERYGSPVYVLNLIKAREKIPRESKLLTE
YTNAVNYLNQFLPDDKKIIYRAWDMSRASKSRDQDVIGTLESIADDIIPKTGFFRNGEDG
ASGLRMQNGVARTNCIDCLDRTNAAQFVIAKRALGYQLQALGLIDHTYIDYDTDAINTFT
NMWHGHGDTIAVQYGGSHLVNTMATYRKLNQWTGHSRDMVESFKRYYNNSFLDAQRQEAY
NLFLGNYVFSKNIPMLWNLSTDYYLHHSDPRTWLATHKQNYINWYNKEHLQKREMPPAPS
ASSALASKRIREFDDYWLEYYRPRAISSFSKMFSFKMRTKLPDYQLQSMHPGEHDLSPFV
VRTDHEPDHQRDRRNTPNKRLTILEPSDELKDIKSNSHNGYSGAMPLQHWLQPSSGRLIP
QAGILKGTQNALVTHSHPTNDPISLTSAYSQPPYNATKAQVAQWSFGQMIADSLNPSLSS
AEAEEYERYVNHPLKVPLVVTSEASLTAASLEERGSNLDLFEYANQSNLEDANLNSIAES
NMADYTDFLTVGDEGLTVNNEDYDKKRYKRYRQWLRGKSLFKQGVEV
Download sequence
Identical sequences A0A022W4F3 A0A022XUG5 A0A178EZT6 F2SRV6
XP_003234727.1.23396 TERG_05318T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]