SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022W7Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022W7Z4
Domain Number 1 Region: 221-406
Classification Level Classification E-value
Superfamily MIR domain 1.11e-61
Family MIR domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022W7Z4
Sequence length 629
Comment (tr|A0A022W7Z4|A0A022W7Z4_TRIRU) Uncharacterized protein {ECO:0000313|EMBL:EZF54535.1} KW=Complete proteome OX=1215330 OS=Trichophyton rubrum CBS 288.86. GN=H103_02718 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MLIGLSGFLAGYNGSFEFKSGEKYPPEVNYTFMRIFNAFFGIMCVPLAYYTARELKFRRP
AVWLITLMVLCENSYATISRFILLDSMLLCFTFTTTLCWARFHRLRHESFSPEWYLWLIL
TGLSIGCVCSVKWVGLFCTALVGLYTAEDLWHKFGDLKMPKTVLAHHLGARVFGLIIVPF
LVYMFSFYIHFLVLENSGTGDAQMSSLFQANLRGTNVGKDSPLEVAIGSKITLKNMGYGG
GLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGPIAFIGDGDVIRLI
HAQTGRNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDVASRDRSKIRTLTT
ALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNIESHVNERLPPSEP
GTYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGLRMCSWDDNVVK
YFLLGNPFVYWGSTLSLGVFSLLVLWYLLRWQRGYDELSMADIDHIHYSGIYPIVGWFLH
YLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIYSVLYVVIIGLFVV
FKDIVFGMEGSNQQWKSLNWLSSWKIANR
Download sequence
Identical sequences A0A022W7Z4 A0A022XZ26 A0A080WW93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]